PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART05G04370.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 202aa    MW: 22011.5 Da    PI: 10.3535
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART05G04370.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.41.9e-142771147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rW++eE+e+++da  ++G + Wk+I   +  ++t+ q++s+ qk+
  OBART05G04370.1 27 RERWSAEEHERFLDALLLFGRD-WKRIEGFVA-TKTAIQIRSHAQKH 71
                     78******************77.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.12E-152177IPR009057Homeodomain-like
PROSITE profilePS5129416.4082276IPR017930Myb domain
TIGRFAMsTIGR015575.2E-152674IPR006447Myb domain, plants
SMARTSM007172.8E-92674IPR001005SANT/Myb domain
PfamPF002491.6E-102771IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-72771IPR009057Homeodomain-like
CDDcd001676.55E-82972No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MAAMAARAAA VGTMKKARKP YTITRPRERW SAEEHERFLD ALLLFGRDWK RIEGFVATKT  60
AIQIRSHAQK HFLKARKFGL AGGLPPPLHP RRAALLRANA AAAAADMMPP PWLPSAGTPS  120
CSGSGESWLA DAAFFSQDET ILLPISPDDL GFAQVYKFIG DVFGSGEPRP VEAHLRRLQG  180
MDPAISETIL LVLKNLEANL SA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1241441e-50AC124144.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBb0099P06, complete sequence.
GenBankAP0149611e-50AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
GenBankCP0126131e-50CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638954.11e-115PREDICTED: protein REVEILLE 8
TrEMBLA0A0D3G3K91e-145A0A0D3G3K9_9ORYZ; Uncharacterized protein
STRINGBGIOSGA018757-PA1e-112(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36423170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09600.15e-28MYB_related family protein